The hemostatic material composition contains a polysaccharide having a reactive group that reacts with a protein to form a crosslinking structure, a hydrophobic solvent, and a crosslinked particle containing one or more compounds selected from the group consisting of a crosslinked protein and a crosslinked polysaccharide.
A61K 38/17 - Peptides ayant plus de 20 amino-acides; Gastrines; Somatostatines; Mélanotropines; Leurs dérivés provenant d'humains
A61K 31/715 - Polysaccharides, c. à d. ayant plus de cinq radicaux saccharide liés les uns aux autres par des liaisons glycosidiques; Leurs dérivés, p.ex. éthers, esters
The hemostatic material composition contains a polysaccharide having a reactive group that reacts with a protein to form a crosslinking structure and contains a hydrophobic solvent.
A61L 24/04 - Adhésifs ou ciments chirurgicaux; Adhésifs pour dispositifs de colostomie contenant des matériaux macromoléculaires
3.
PRODUCTION METHOD OF POLYPEPTIDE, TAG, EXPRESSION VECTOR, EVALUATION METHOD OF POLYPEPTIDE, PRODUCTION METHOD OF NUCLEIC ACID DISPLAY LIBRARY, AND SCREENING METHOD
Provided is a production method of a polypeptide in which expressing a polypeptide as a tagged polypeptide is included, the method including expressing the tagged polypeptide from a nucleic acid containing a base sequence encoding a tag consisting of an amino acid sequence set forth in SEQ ID NO: 1, which is arranged immediately after a start codon, and a base sequence encoding a polypeptide that is arranged in-frame downstream of the base sequence encoding the tag,SEQ ID NO: 1: Val-Lys-Lys-(Xaa)n. (Xaa)n is a chain of n pieces of any amino acids, where n is an integer of 1 to 8, and the amino acids constituting (Xaa)n may be one type of amino acid or two or more types of amino acids.
C07K 5/103 - Tétrapeptides la chaîne latérale du premier amino-acide étant acyclique, p.ex. Gly, Ala
C07K 7/06 - Peptides linéaires ne contenant que des liaisons peptidiques normales ayant de 5 à 11 amino-acides
C12N 15/63 - Introduction de matériel génétique étranger utilisant des vecteurs; Vecteurs; Utilisation d'hôtes pour ceux-ci; Régulation de l'expression
C12N 15/67 - Méthodes générales pour favoriser l'expression
C12P 21/02 - Préparation de peptides ou de protéines comportant une séquence connue de plusieurs amino-acides, p.ex. glutathion
C12P 21/04 - Peptides ou polypeptides cycliques ou pontés, p.ex. bacitracine
C40B 40/08 - Bibliothèques comprenant de l'ARN ou de l'ADN codant des protéines, p.ex. bibliothèques de gènes
C40B 40/10 - Bibliothèques comprenant des peptides ou des polypeptides ou leurs dérivés
4.
COMPOUND OR SALT THEREOF, LIPID PARTICLES, AND PHARMACEUTICAL COMPOSITION
The present invention addresses the problem of providing: a compound or a salt thereof which constitutes lipid particles that make it possible to achieve a high nucleic acid encapsulation rate and excellent nucleic acid delivery; and lipid particles and a pharmaceutical composition which use the same and make it possible to achieve a high nucleic acid encapsulation rate and excellent nucleic acid delivery. The present invention provides a compound represented by formula (1) or a salt thereof. In the formula, the symbols have the meanings as defined in the specification of the present application.
C07C 219/16 - Composés contenant des groupes amino et hydroxy estérifiés liés au même squelette carboné ayant des groupes hydroxy estérifiés et des groupes amino liés à des atomes de carbone acycliques du même squelette carboné le squelette carboné étant acyclique et saturé au moins un des groupes hydroxy étant estérifié par un acide inorganique ou un de ses dérivés
A61K 47/18 - Amines; Amides; Urées; Composés d’ammonium quaternaire; Acides aminés; Oligopeptides ayant jusqu’à cinq acides aminés
5.
INFORMATION PROCESSING APPARATUS, INFORMATION PROCESSING METHOD, AND INFORMATION PROCESSING PROGRAM
This information processing device is equipped with at least one processor. Said processor performs processing which involves: receiving an input of structure data which expresses the structure of a chemical substance and an evaluation function for evaluating the specific performance of the chemical substance; extracting a known chemical substance, the basic structure of which is shared by the input structure represented by the inputted structure data, from a database for recording structure data which expresses said chemical substance structure for each of a plurality of known chemical substances; generating a novel structure by modifying the input structure on the basis of the extracted known chemical substance structure or modifying the extracted known chemical substance structure; deriving an indicator value pertaining to specific performance for the generated novel structure; deriving an evaluation value for the novel structure on the basis of the derived indicator value and the evaluation function; and displaying the novel structure according to the evaluation value.
This information processing device is provided with at least one processor. The processor performs a process comprising: receiving the inputs of partial structure data indicating a partial structure of a chemical substance, and a condition regarding an index value indicating performance of the chemical substance; with respect to each of a plurality of known chemical substances, extracting, from a database in which structure data indicating the structure of the chemical substance is recorded, a known chemical substance having an input partial structure that is the partial structure indicated by the partial structure data and satisfying the condition; extracting a partial structure other than the input partial structure included in the structure of the extracted known chemical substance, as a co-occurring partial structure; and displaying the extracted co-occurring partial structure.
This information processing device: performs a control to display on a display device the structure of the chemical substance of an object to be processed, and a first index value indicating the function or structure of said chemical substance; accepts an operation to change the structure of the chemical substance displayed on the display device; performs a control to display on the display device the structure of the chemical substance after the change operation, and a second index value indicating the function or structure of the chemical substance after the change operation; and, when there is a partial structure that contributes to the change in value from the first index value to the second index value in the chemical substance after the change operation, performs a control to highlight the display of said partial structure.
The present disclosure relates to ?v?3 and/or ?v?5 integrins antagonist radiopharmaceuticals and their use in a theragnostic approach for selection and therapy of human subjects with tumors overexpressing ?v?3 and/or ?v?5 integrins. In particular, the present disclosure relates to a pharmaceutical composition of ?v 177Lu radiolabeled ?v?3 and/or ?v?5 integrins antagonist, for use in treating tumors overexpressing ?v?3 and/or ?v?5 integrins in a human subject eligible for said treatment, wherein said subject has been selected for the treatment by PET/CT or PET/MRI or SPECT/CT or SPECT/MRI imaging with the same ?v?3 and/or ?v?5 integrins antagonist but with 68-Ga as radiometal for use as imaging agent.
This information processing device: performs a first search, in structure data representing the structure of a chemical substance to be tested, to search for partial structures included in partial structure data in which partial structures of the chemical substance and index values representing the performance or structure of these partial structures are associated; performs a second search to search for chemical substances that include the partial structures extracted by the first search, the second search performed in past data in which the structure of chemical substances and index values representing the performance or structure of the chemical substances and obtained through experimentation are associated; derives, on the basis of the total number of chemical substances extracted by the second search and the index values corresponding to those chemical substances, the reliability of the index values of the partial structures; and applies control to display, on a display device, the partial structures extracted by the first search and the reliability of those partial structures.
The present disclosure provides methods for generating and/or purifying secretomes, extracellular vesicles, and fractions thereof, from progenitor cells; and provides compositions containing such generated secretomes, extracellular vesicles, and fractions thereof. The present disclosure further provides methods for analyzing activities, and the functionality and potency, of such secretomes, extracellular vesicles, and fractions thereof. The present disclosure also relates to the therapeutic use of secretomes, extracellular vesicles, and fractions thereof. The present disclosure further relates to a good manufacturing practices (GMP)-ready, scalable, culture protocol for the release of clinic-ready secretomes.
The present disclosure provides methods for generating and/or purifying secretomes, extracellular vesicles, and fractions thereof, from cells, such as progenitor cells; and methods for analyzing activities, and the functionality and potency, of such secretomes, extracellular vesicles, and fractions thereof. The present disclosure also relates to the therapeutic use of secretomes, extracellular vesicles, and fractions thereof, analyzed using such methods.
C12Q 1/02 - Procédés de mesure ou de test faisant intervenir des enzymes, des acides nucléiques ou des micro-organismes; Compositions à cet effet; Procédés pour préparer ces compositions faisant intervenir des micro-organismes viables
12.
MAGNETORHEOLOGICAL FLUID, METHOD FOR MANUFACTURING MAGNETORHEOLOGICAL FLUID, AND MAGNETORHEOLOGICAL FLUID DEVICE
Provided is a magnetorheological fluid containing magnetic particles, a carrier fluid, and an organic molybdenum compound, the magnetic particle content being 35?50 vol% (inclusive) with respect to the volume of the magnetorheological fluid, the viscosity of the carrier fluid measured by an electromagnetic rotary viscometer at a measurement temperature of 25°C being 10 mPa·s (millipascal seconds) or more, and the shear viscosity of the magnetorheological fluid measured at a shear rate of 1000 s?1 at a measurement temperature of 25°C being 500 mPa·s or less. Also provided are a magnetorheological fluid device including said magnetorheological fluid, and a method for manufacturing said magnetorheological fluid. The method for manufacturing said magnetorheological fluid includes resonant acoustic mixing of a mixture containing said magnetic particles, carrier fluid, and organic molybdenum compound.
H01F 1/44 - Aimants ou corps magnétiques, caractérisés par les matériaux magnétiques appropriés; Emploi de matériaux spécifiés pour leurs propriétés magnétiques en liquides magnétiques, p.ex. ferrofluides
F16D 57/00 - Freins à résistance liquide; Freins à résistance à l'air
F16F 9/53 - Moyens pour le réglage des caractéristiques des amortisseurs en faisant varier la viscosité du fluide, p.ex. électromagnétiques
An object of an aspect of the present invention is to provide an anti-tumor agent that exhibits a remarkably excellent anti-tumor effect. According to the present invention, there is provided an anti-tumor agent for curing cancer, the anti-tumor agent containing a liposome containing an inner water phase and an aqueous solution dispersing the liposome, which constitutes an outer water phase, in which the liposome encompasses gemcitabine or a salt thereof, a lipid constituting the liposome contains at least hydrogenated soybean phosphatidylcholine, 1,2-distearoyl-3-phosphatidylethanolamine-polyethylene glycol, and cholesterol, and the gemcitabine or the salt thereof encompassed in the liposome is administered at a dose rate of 1.0 mg/m2 body surface area to 240 mg/m2 body surface area per administration.
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
14.
MARKERS SPECIFIC FOR PLURIPOTENT STEM CELLS, AND METHODS OF USING THE SAME
The present disclosure provides markers specific for pluripotent stem cells. In particular, the present disclosure relates to nucleic acid and polypeptide markers that are selectively expressed by pluripotent stem cells; and to methods for detecting the presence and/or absence of one or a plurality of pluripotent stem cells, by detecting such markers.
C12Q 1/6881 - Produits d’acides nucléiques utilisés dans l’analyse d’acides nucléiques, p.ex. amorces ou sondes pour le typage de tissu ou de cellule, p.ex. sondes d’antigène leucocytaire humain [HLA]
An object of the present invention is to provide a lipid composition capable of achieving excellent nucleic acid delivery for a wide variety of nucleic acids. According to the present invention, there is provided a lipid composition containing a first lipid which is a lipid represented by Formula (1) or a salt thereof, sterols, and nucleic acid, in which a ratio of the number of moles of the first lipid in the lipid composition to the number of moles of sterols in the lipid composition is 0.300 or more and less than 1.299. In the formula, X represents -NR1- or -O-, R1 represents a hydrogen atom, a hydrocarbon group, or the like, R2 and R3 each independently represent a hydrogen atom, a hydrocarbon group, or the like, R4, R5, R6, R7, R8, R9, R10, R11, and R12 each independently represent a hydrogen atom or an alkyl group,groups in any one or more pairs among R4 and R5, R10 and R5, R5 and R12, R4 and R6, R5 and R6, R6 and R7, R6 and R10, R12 and R7, and R7 and R8 may be linked to each other to form a 4- to 7-membered ring which may contain an O atom, a, b, c, and d are each independently represent an integer of 0 to 3, a + b is 1 or more, and c + d is 1 or more.
The present invention addresses the problem of providing a lipid composition which enables excellent nucleic acid delivery. According to the present invention, a lipid composition is provided, which contains a lipid represented by formula (1) or a salt thereof, a nonionic lipid, a lipid having a nonionic hydrophilic polymer structure and a nucleic acid and contains or does not contain a zwitterionic lipid, wherein the requirement represented by the formula: 40 < (A)-(B) ? 90 is satisfied, in which (A) represents the molar ratio, in terms of percentage, of the lipid represented by formula (1) or the salt thereof to all of the lipids constituting the lipid composition and (B) represents the molar ratio, in terms of percentage, of the zwitterionic lipid to all of the lipids constituting the lipid composition. In the formula, X represents -NR1- or -O-; R1 represents a hydrogen atom, a hydrocarbon group or the like; R2 and R3 independently represent a hydrogen atom, a hydrocarbon group or the like; R4, R5, R6, R7, R8, R9, R10, R11 and R12 independently represent a hydrogen atom or an alkyl group; residues of at least one pair selected from R4 and R5, R10 and R5, R5 and R12, R4 and R6, R5 and R6, R6 and R7, R6 and R10, R12 and R7, and R7 and R8 may be linked to each other to form a 4- to 7-membered ring which may contain an O atom; and a, b, c and d independently represent an integer of 0 to 3, wherein a+b is 1 or more and c+d is 1 or more.
A61K 48/00 - Préparations médicinales contenant du matériel génétique qui est introduit dans des cellules du corps vivant pour traiter des maladies génétiques; Thérapie génique
A61K 31/7088 - Composés ayant au moins trois nucléosides ou nucléotides
A61K 31/713 - Acides nucléiques ou oligonucléotides à structure en double-hélice
A61K 47/14 - Esters d’acides carboxyliques, p.ex. acides gras monoglycérides, triglycérides à chaine moyenne, parabènes ou esters d’acide gras de PEG
A61K 47/18 - Amines; Amides; Urées; Composés d’ammonium quaternaire; Acides aminés; Oligopeptides ayant jusqu’à cinq acides aminés
A61K 47/24 - Composés organiques, p.ex. hydrocarbures naturels ou synthétiques, polyoléfines, huile minérale, gelée de pétrole ou ozocérite contenant des atomes autres que des atomes de carbone, d'hydrogène, d'oxygène, d'halogènes, d'azote ou de soufre, p.ex. cyclométhicone ou phospholipides
A61K 47/34 - Composés macromoléculaires obtenus par des réactions autres que celles faisant intervenir uniquement des liaisons non saturées carbone-carbone, p.ex. polyesters, acides polyaminés, polysiloxanes, polyphosphazines, copolymères de polyalkylène glycol o
One purpose of this invention is to provide a method, program, and device that make it possible to calculate a feature value that accurately represents the chemical properties of a structure of interest. Another purpose of this invention is to provide a method and program that make it possible to efficiently screen for a drug candidate compound using a feature value. Another purpose of this invention is to provide a method that makes it possible to efficiently create the three-dimensional structure of a drug candidate compound using a feature value. Similarity between the degrees of probe accumulation of structures of interest indicates similarity between the chemical properties of the structures of interest; that is, structures of interest having similar feature values calculated according to a first embodiment have similar chemical properties. Therefore, the first embodiment makes it possible to calculate a feature value that accurately represents the chemical properties of a structure of interest.
G16B 40/00 - TIC spécialement adaptées aux biostatistiques; TIC spécialement adaptées à l’apprentissage automatique ou à l’exploration de données liées à la bio-informatique, p.ex. extraction de connaissances ou détection de motifs
G01N 33/50 - Analyse chimique de matériau biologique, p.ex. de sang ou d'urine; Test par des méthodes faisant intervenir la formation de liaisons biospécifiques par ligands; Test immunologique
18.
METHOD FOR PRODUCING PEPTIDE COMPOUND, PROTECTING GROUP-FORMING REAGENT, AND CONDENSED POLYCYCLIC AROMATIC HYDROCARBON COMPOUND
Provided are: a method for producing a peptide compound, the method including a step for using a fused polycyclic aromatic hydrocarbon compound represented by formula (1); a protecting group-forming reagent that contains said compound; and said compound. In formula (1), ring A denotes a fused polycyclic aromatic hydrocarbon ring, YA moieties each independently denote -CH2OH, -CH2NHR, -CH2SH or -CH2X0, R denotes a hydrogen atom, an alkyl group or an aralkyl group, X0 denotes Cl, Br or I, k denotes an integer between 1 and 5, n denotes 1 or 2, and RA moieties each independently denote an aliphatic hydrocarbon group or an organic group having an aliphatic hydrocarbon group.
C07C 43/23 - Ethers une liaison sur l'oxygène de la fonction éther étant sur un atome de carbone d'un cycle aromatique à six chaînons contenant des groupes hydroxyle ou O-métal
C07K 1/06 - Procédés généraux de préparation de peptides utilisant des groupes protecteurs ou des agents d'activation
19.
METHOD FOR PRODUCING PEPTIDE COMPOUND, PROTECTING GROUP-FORMING REAGENT, AND AROMATIC HETEROCYCLIC COMPOUND
Provided are: a method for producing a peptide compound, the method including a step for using an aromatic heterocyclic compound represented by formula (1); a protecting group-forming reagent that contains said compound; and said compound. In formula (1), ring A denotes an aromatic heterocyclic ring, YA moieties each independently denote -OH, -NHR, -SH or -X0, X0 denotes Cl, Br or I, RA and RC moieties each independently denote an aliphatic hydrocarbon group or an organic group having an aliphatic hydrocarbon group, RB moieties each independently denote a monovalent aliphatic hydrocarbon group, a (1+c)-valent aromatic group or a (1+c)-valent heteroaromatic group, RB is a monovalent aliphatic hydrocarbon group in a case where both a and c are 0, and the number of carbon atoms in an aliphatic hydrocarbon group in at least one of RA, RB, and RC is 12 or more.
C07D 209/08 - Indoles; Indoles hydrogénés avec uniquement des atomes d'hydrogène ou des radicaux ne contenant que des atomes d'hydrogène et de carbone, liés directement aux atomes de carbone de l'hétérocycle
C07D 207/333 - Radicaux substitués par des atomes d'oxygène ou de soufre
C07D 209/86 - Carbazoles; Carbazoles hydrogénés avec uniquement des atomes d'hydrogène, des radicaux hydrocarbonés ou des radicaux hydrocarbonés substitués, liés directement aux atomes de carbone du système cyclique
C07D 231/12 - Composés hétérocycliques contenant des cycles diazole-1, 2 ou diazole-1, 2 hydrogéné non condensés avec d'autres cycles comportant deux ou trois liaisons doubles entre chaînons cycliques ou entre chaînons cycliques et chaînons non cycliques avec uniquement des atomes d'hydrogène, des radicaux hydrocarbonés ou des radicaux hydrocarbonés substitués, liés directement aux atomes de carbone du cycle
The present invention addresses the problem of providing an antitumor agent for acute myeloid leukemia, the antitumor agent exhibiting practical effects on acute myeloid leukemia. According to the present invention, provided is an antitumor agent for acute myeloid leukemia, the antitumor agent containing a compound, such as (S,E)-N-(1-((5-(2-((4-cyanophenyl)amino)-4-(propylamino)pyrimidin-5-yl)-4-pentyn-1-yl)amino)-1-oxopropan-2-yl)-4-(dimethylamino)-N-methyl-2-butenamide, represented by general formula [1] specified in the present specification, or a salt thereof, wherein the amount of the antitumor agent administered per dose is within a predetermined range.
Provided are a medical-image processing device and method, a machine learning system, and a program that can restrain the amount of communication, alleviating the burden of processing for relearning or additional learning performed by a machine learning device. A medical-image processing device (13) is provided with: a learner (26) that performs additional learning for a first computer-aided diagnosis device on the basis of an input medical image; an evaluation unit that compares a second computer-aided diagnosis device, which is obtained through the additional learning, with the first computer-aided diagnosis device to evaluate whether or not learned difference information resulting from the additional learning contributes to a performance improvement of the first computer-aided diagnosis device; a communication determination unit that determines, on the basis of the result of the evaluation, whether or not it is necessary to communicate the learned difference information; and a communication unit (34) that outputs the learned difference information according to the result of the determination by the communication determination unit.
The present invention addresses the problem of providing a medicine prepared by combining a liposome composition with an immune checkpoint blockade, wherein gemcitabine is encapsulated in a dissolved state in liposomes in the liposome composition. According to the present invention, a medicine which is a combination of (A) a liposome composition with (B) an immune checkpoint blockade is provided, wherein the liposome composition comprises liposomes each having an inner aqueous phase and an aqueous solution constituting an outer aqueous phase and having the liposomes dispersed therein, gemcitabine is encapsulated in a dissolved state in the liposomes, and the liposome composition and the immune checkpoint blockade are administered simultaneously or sequentially.
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
The present invention addresses the problem of providing: a compound or a salt thereof, which constitutes lipid particles that enable the achievement of high nucleic acid encapsulation rate and excellent nucleic acid delivery; and lipid particles which use this compound or a salt thereof, and which enable the achievement of high nucleic acid encapsulation rate and excellent nucleic acid delivery. The present invention provides a compound represented by formula (1) or a salt thereof. In the formula, X represents -NR1- or -O-; R1 represents a hydrogen atom, a hydrocarbon group or the like; each of R2 and R3 independently represents a hydrogen atom, a hydrocarbon group or the like; each of R4, R5, R6, R7, R8, R9, R10, R11 and R12 independently represents a hydrogen atom, an alkyl group or the like; one or more pairs selected from among a pair of R4 and R5, a pair of R10 and R5, a pair of R5 and R12, a pair of R4 and R6, a pair of R5 and R6, a pair of R6 and R7, a pair of R6 and R10, a pair of R12 and R7, and a pair of R7 and R8 may combine with each other and form a 4- to 7-membered ring that may contain an O atom; and each of a, b, c and d independently represents an integer of 0-3, provided that (a + b) is 1 or more and (c + d) is 1 or more.
C07C 219/16 - Composés contenant des groupes amino et hydroxy estérifiés liés au même squelette carboné ayant des groupes hydroxy estérifiés et des groupes amino liés à des atomes de carbone acycliques du même squelette carboné le squelette carboné étant acyclique et saturé au moins un des groupes hydroxy étant estérifié par un acide inorganique ou un de ses dérivés
A61K 47/24 - Composés organiques, p.ex. hydrocarbures naturels ou synthétiques, polyoléfines, huile minérale, gelée de pétrole ou ozocérite contenant des atomes autres que des atomes de carbone, d'hydrogène, d'oxygène, d'halogènes, d'azote ou de soufre, p.ex. cyclométhicone ou phospholipides
C07C 271/12 - Esters des acides carbamiques ayant des atomes d'oxygène de groupes carbamate liés à des atomes de carbone acycliques avec les atomes d'azote des groupes carbamate liés à des atomes d'hydrogène ou à des atomes de carbone acycliques à des atomes d'hydrogène ou à des atomes de carbone de radicaux hydrocarbonés non substitués
C07C 271/16 - Esters des acides carbamiques ayant des atomes d'oxygène de groupes carbamate liés à des atomes de carbone acycliques avec les atomes d'azote des groupes carbamate liés à des atomes d'hydrogène ou à des atomes de carbone acycliques à des atomes de carbone de radicaux hydrocarbonés substitués par des atomes d'oxygène liés par des liaisons simples
C07C 271/22 - Esters des acides carbamiques ayant des atomes d'oxygène de groupes carbamate liés à des atomes de carbone acycliques avec les atomes d'azote des groupes carbamate liés à des atomes d'hydrogène ou à des atomes de carbone acycliques à des atomes de carbone de radicaux hydrocarbonés substitués par des groupes carboxyle
C07D 211/42 - Atomes d'oxygène liés en position 3 ou 5
C07D 211/46 - Atomes d'oxygène liés en position 4 comportant un atome d'hydrogène comme second substituant en position 4
C07D 295/13 - Composés hétérocycliques contenant des cycles polyméthylène imine d'au moins cinq chaînons, des cycles aza-3 bicyclo [3.2.2] nonane, piperazine, morpholine ou thiomorpholine, ne comportant que des atomes d'hydrogène liés directement aux atomes de car avec des radicaux hydrocarbonés substitués liés aux atomes d'azote du cycle substitués par des atomes d'azote liés par des liaisons simples ou doubles avec les atomes d'azote du cycle et les atomes d'azote substituants liés à la même chaîne carbonée, qui n'est pas interrompue par des cycles carbocycliques à une chaîne acyclique saturée
24.
PENAM DERIVATIVE OR SALT THEREOF, PHARMACEUTICAL COMPOSITION, AND APPLICATIONS THEREOF
The problem addressed by the present invention is to provide compounds and pharmaceutical compositions that demonstrate strong antibacterial activity against gram-negative bacteria and drug-resistant gram-negative bacteria. Compounds represented by general formula [1] (in the formula, each symbol is as described in the specification.) or salts thereof have strong antibacterial activity against gram-negative bacteria, including Pseudomonas aeruginosa, and drug-resistant gram-negative bacteria, including multidrug-resistant Pseudomonas aeruginosa, and pharmaceutical compositions containing these compounds or salts are useful as antimicrobials.
C07D 499/00 - Composés hétérocycliques contenant des systèmes cycliques thia-4 aza-1 bicyclo [3.2.0] heptane, c. à d. des composés contenant un système cyclique de formule p.ex. pénicillines, pénèmes; Ces systèmes cycliques étant ultérieurement condensés, p.ex. condensés en position 2,3 avec des hétérocycles contenant de l'oxygène, de l'azote ou du soufre
A61K 31/431 - Composés contenant des systèmes cycliques thia-4 aza-1 bicyclo [3.2.0] heptane, c.à d. composés contenant un système cyclique de formule , p.ex. pénicillines, pénèmes contenant d'autres systèmes hétérocycliques, p.ex. ticarcilline, azlocilline, oxacilline
A61K 31/4439 - Pyridines non condensées; Leurs dérivés hydrogénés contenant d'autres systèmes hétérocycliques contenant un cycle à cinq chaînons avec l'azote comme hétéro-atome du cycle, p.ex. oméprazole
A61K 31/497 - Pyrazines non condensées contenant d'autres hétérocycles
The present invention addresses the problem of providing an antitumor agent and an antitumor kit having a superior antitumor effect in comparison to gemcitabine, an antitumor platinum complex and a combination therapy thereof, and an antitumor effect potentiator. Provided is an antitumor agent that comprises an antitumor platinum complex and 1-(2-deoxy-2-fluoro-4-thio-ß-D-arabinofuranosyl)cytosine or a salt thereof.
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
Provided is a microfluidic channel device comprising: a first microfluidic channel formed in a first flow path member; a second microfluidic channel formed in a second flow path member and at least partially overlapping with the first microfluidic channel in a plan view, a step part being formed between the second microfluidic channel and the first microfluidic channel; a porous film having a plurality of pores that penetrate the porous film in the thickness direction, the porous film being disposed between the first flow path member and the second flow path member so as to separate the first microfluidic channel and the second microfluidic channel from each other; and a reinforcing member disposed between the porous film and the first flow path member or the second flow path member and having higher rigidity than the porous film, the reinforcing member reinforcing at least a portion, of the porous film, that faces the step part.
B81B 3/00 - Dispositifs comportant des éléments flexibles ou déformables, p.ex. comportant des membranes ou des lamelles élastiques
B01J 19/00 - Procédés chimiques, physiques ou physico-chimiques en général; Appareils appropriés
G01N 37/00 - RECHERCHE OU ANALYSE DES MATÉRIAUX PAR DÉTERMINATION DE LEURS PROPRIÉTÉS CHIMIQUES OU PHYSIQUES - Détails non couverts par les autres groupes de la présente sous-classe
C12M 1/34 - Mesure ou test par des moyens de mesure ou de détection des conditions du milieu, p.ex. par des compteurs de colonies
The purpose of the present invention is to provide a flow path device in which both optical measurements and electrical measurements can be performed. This purpose is met by comprising a first flow path member having a first flow path, a second flow path member having a second flow path, a porous film provided between the first flow path member and the second flow path member, and a pair of transparent electrodes provided with the first flow path and the second flow path interposed therebetween.
G01N 37/00 - RECHERCHE OU ANALYSE DES MATÉRIAUX PAR DÉTERMINATION DE LEURS PROPRIÉTÉS CHIMIQUES OU PHYSIQUES - Détails non couverts par les autres groupes de la présente sous-classe
28.
METHOD FOR INDUCING DIFFERENTIATION OF PLURIPOTENT STEM CELLS INTO INTESTINAL EPITHELIAL CELLS
PUBLIC UNIVERSITY CORPORATION NAGOYA CITY UNIVERSITY (Japon)
FUJIFILM CORPORATION (Japon)
Inventeur(s)
Matsunaga, Tamihide
Iwao, Takahiro
Kabeya, Tomoki
Mima, Shinji
Miyashita, Toshihide
Abrégé
The present invention addresses the problem of providing a novel means whereby cells showing a function more closely similar to the function of intestinal epithelial cells of a living body can be easily and efficiently prepared. According to the present invention, differentiation of pluripotent stem cells into intestinal epithelial cells is induced by: (1) a step for differentiating the pluripotent stem cells into intestinal stem cell-like cells; and (2) a step for differentiating the intestinal stem cell-like cells obtained in step (1) into intestinal epithelial cell-like cells with the combined use of an MEK1 inhibitor, a DNA methylation inhibitor, a TGFß receptor inhibitor, EGF and a cAMP activator.
C12N 1/00 - Micro-organismes, p.ex. protozoaires; Compositions les contenant; Procédés de culture ou de conservation de micro-organismes, ou de compositions les contenant; Procédés de préparation ou d'isolement d'une composition contenant un micro-organisme; Leurs milieux de culture
C12N 5/10 - Cellules modifiées par l'introduction de matériel génétique étranger, p.ex. cellules transformées par des virus
C12Q 1/02 - Procédés de mesure ou de test faisant intervenir des enzymes, des acides nucléiques ou des micro-organismes; Compositions à cet effet; Procédés pour préparer ces compositions faisant intervenir des micro-organismes viables
29.
ANTITUMOR AGENT FOR BILIARY TRACT CANCER AND METHOD FOR TREATING BILIARY TRACT CANCER
The purpose of the present invention is to provide an antitumor agent for biliary cancer which exhibits an effect against biliary cancer, and a treatment method of biliary cancer. An antitumor agent for biliary cancer is provided that contains 1-(2-deoxy-2-fluoro-4-thio-ß-D-arabinofuranosyl)cytosine or a salt or a prodrug thereof.
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
There is provided a medical examination support apparatus in which the history of diagnosis can be easily grasped at a glance, and an operation method and an operation program thereof A screen output control unit (66) of a medical examination support server (12) generates a log display screen (95) and transmits the log display screen (95) to a client terminal (11). In a collective display region (97) in the log display screen (95), an APL block (99) and a MOL block (100) are collectively displayed in a time series in a distinguishable manner. The APL block (99) is a display block of an automatic processing log APL which is a history of automatically performing analysis processing on examination data obtained in a medical examination performed on a patient by a diagnosis support algorithm (30) to output a result of the analysis processing as diagnosis support information for supporting diagnosis of a doctor. The MOL block (100) is a display block of a manual operation log MOL which is a history of a manual operation of the doctor with respect to the examination data.
There are provided a medical examination support apparatus which can select a suitable diagnosis support algorithm for a plurality of pieces of examination data without the intervention of a doctor, and an operation method and an operation program thereof. A request receiving unit (60) of a medical examination support server (12) receives at least two selection instructions among a plurality of pieces of examination data obtained in a medical examination performed on a patient. An algorithm selection unit (62) selects a suitable diagnosis support algorithm (30C) according to at least two pieces of the examination data from among the plurality of diagnosis support algorithms (30). An analysis processing unit (63) performs analysis processing by the suitable diagnosis support algorithm (30C). A screen output control unit (65) controls an output of an information display screen (95) including an information display region (102) in which diagnosis support information of the suitable diagnosis support algorithm (30C) is displayed.
The object of the present invention is to provide a therapeutic agent for use in treating hyperphosphatemia capable of sufficiently decreasing a serum phosphorus concentration with a small dose, and particles therefor. The present invention provides a therapeutic agent for hyperphosphatemia, which comprises, as an active ingredient, a particle containing a crosslinked polymer having at least a repeating unit A represented by the following formula (1-1) or (1-2) and a repeating unit B represented by the following formula (2-1) or (2-2), or a salt thereof, wherein the particle has an average particle diameter of 20 to 150 µm and a swelling rate of 9 to 16 mL/g. (see formula (1-2)(see formula(1-2) (see formula (2-1)(see formula(2-2)
A61K 9/24 - Pilules, pastilles ou comprimés du type à libération prolongée ou discontinue en doses unitaires constituées de couches ou feuilletées
A61K 9/32 - Revêtements organiques contenant des polymères synthétiques solides
A61K 47/26 - Hydrates de carbone, p.ex. polyols ou sucres alcoolisés, sucres aminés, acides nucléiques, mono-, di- ou oligosaccharides; Leurs dérivés, p.ex. polysorbates, esters d’acide gras de sorbitan ou glycyrrhizine
A method for producing a cell laminate, said cell laminate comprising cell layers on the both faces of a porous film, by using a container consisting of a bottom and a side wall rising from the outer edge of the bottom, the porous film, and a holding member holding the porous film at a position where the porous film is not in contact with the inner bottom face of the container so as to oppose the porous film to the inner bottom face, said method comprising: culturing first cells in a liquid medium, which is in contact with the inner bottom face of the container and the surface of the porous film, in such a state that the porous film is held by the holding member at a position where the porous film is not in contact with the inner bottom face of the container so as to oppose the porous film to the inner bottom face and the bottom of the container is positioned upper than the porous film along the direction of the gravity; and culturing the first cells on the lower face of the porous film and culturing second cells on the upper face of the porous film in such a state that the porous film is held by the holding member at a position where the porous film is not in contact with the inner bottom face of the container so as to oppose the porous film to the inner bottom face and the bottom of the container is positioned lower than the porous film along the direction of the gravity.
C12M 3/04 - Appareillage pour la culture de tissus, de cellules humaines, animales ou végétales, ou de virus comportant des moyens fournissant des couches minces
This micro flow passage device includes: a flow passage unit which is configured from a plurality of flow passage members which are stacked in a thickness direction to define a micro flow passage, wherein at least one flow passage member comprises a resilient material; and a holding member which is provided separately from or integrally with the flow passage unit, and which holds the flow passage unit in a state of compression in the thickness direction.
B81B 1/00 - Dispositifs sans éléments mobiles ou flexibles, p.ex. dispositifs capillaires microscopiques
B01J 19/00 - Procédés chimiques, physiques ou physico-chimiques en général; Appareils appropriés
G01N 37/00 - RECHERCHE OU ANALYSE DES MATÉRIAUX PAR DÉTERMINATION DE LEURS PROPRIÉTÉS CHIMIQUES OU PHYSIQUES - Détails non couverts par les autres groupes de la présente sous-classe
C12M 3/00 - Appareillage pour la culture de tissus, de cellules humaines, animales ou végétales, ou de virus
The present disclosure provides a blood vessel model including: a pair of channel members, mutually opposing each other, each of which includes an opposing face in which a respective microchannel is formed; and a porous membrane that includes plural through-holes penetrating in a thickness direction, that is disposed between the opposing faces of the pair of channel members, and that partitions between the microchannels, wherein the porous membrane is provided with a vascular endothelial cell layer so as to cover one face facing one of the microchannels, an average opening diameter of the through-holes is from 1 µ?? to 20 µm, and an opening coverage ratio of the through-holes is from 30% to 70%.
G01N 33/50 - Analyse chimique de matériau biologique, p.ex. de sang ou d'urine; Test par des méthodes faisant intervenir la formation de liaisons biospécifiques par ligands; Test immunologique
A living tissue model device includes: a first liquid compartment storing a liquid composition; a second liquid compartment storing a liquid composition; and a cell layered body disposed between the first liquid compartment and the second liquid compartment, as a partition between both compartments. A vascular wall model includes: a porous membrane having a honeycomb structure; a vascular endothelial cell layer disposed on one face of the porous membrane; and a smooth muscle cell layer, or a mesenchymal stem cell layer, disposed on another face of the porous membrane. A vascular wall model device includes: a first liquid compartment storing a liquid composition; a second liquid compartment storing a liquid composition; and a vascular wall model disposed between the first liquid compartment and the second liquid compartment, as a partition between both compartments. Applications of these models or model devices are also provided.
C12M 3/06 - Appareillage pour la culture de tissus, de cellules humaines, animales ou végétales, ou de virus avec des moyens de filtration, d'ultrafiltration, d'osmose inverse ou de dialyse
C12N 5/071 - Cellules ou tissus de vertébrés, p.ex. cellules humaines ou tissus humains
C12N 5/077 - Cellules mésenchymateuses, p.ex. cellules osseuses, cellules de cartilage, cellules stromales médulaires, cellules adipeuses ou cellules musculaires
C12M 3/00 - Appareillage pour la culture de tissus, de cellules humaines, animales ou végétales, ou de virus
C12M 3/04 - Appareillage pour la culture de tissus, de cellules humaines, animales ou végétales, ou de virus comportant des moyens fournissant des couches minces
C12N 5/00 - Cellules non différenciées humaines, animales ou végétales, p.ex. lignées cellulaires; Tissus; Leur culture ou conservation; Milieux de culture à cet effet
C12N 11/00 - Enzymes fixées sur un support ou immobilisées; Cellules microbiennes fixées sur un support ou immobilisées; Leur préparation
C12Q 1/00 - Procédés de mesure ou de test faisant intervenir des enzymes, des acides nucléiques ou des micro-organismes; Compositions à cet effet; Procédés pour préparer ces compositions
C12Q 1/02 - Procédés de mesure ou de test faisant intervenir des enzymes, des acides nucléiques ou des micro-organismes; Compositions à cet effet; Procédés pour préparer ces compositions faisant intervenir des micro-organismes viables
37.
LIPOSOME COMPOSITION AND PHARMACEUTICAL COMPOSITION
The present invention addresses the problem of providing a liposome composition and a pharmaceutical composition that exhibit a high AUC. The present invention provides: a liposome composition that contains, as constituent components of the liposome membrane, a diacylphosphatidylethanolamine modified by a hydrophilic polymer, a dihydrosphingomyelin, and cholesterols; and a pharmaceutical composition containing the liposome composition, wherein the liposome composition encapsulates a drug, an inner aqueous phase thereof contains ammonium sulfate, and the molar ratio of sulfate ions in the inner aqueous phase to the drug in the entire aqueous phase is equal to or greater than 0.36.
A61K 31/4745 - Quinoléines; Isoquinoléines condensées en ortho ou en péri avec des systèmes hétérocycliques condensées avec des systèmes cycliques ayant l'azote comme hétéro-atome d'un cycle, p.ex. phénanthrolines
A61K 31/704 - Composés ayant des radicaux saccharide liés à des composés non-saccharide par des liaisons glycosidiques liés à un composé carbocyclique, p.ex. phloridzine liés à un système carbocyclique condensé, p.ex. sennosides, thiocolchicosides, escine, daunorubicine, digitoxine
A61K 47/24 - Composés organiques, p.ex. hydrocarbures naturels ou synthétiques, polyoléfines, huile minérale, gelée de pétrole ou ozocérite contenant des atomes autres que des atomes de carbone, d'hydrogène, d'oxygène, d'halogènes, d'azote ou de soufre, p.ex. cyclométhicone ou phospholipides
Provided is a cyclic peptide having excellent antibody binding properties and improved chemical resistance. The cyclic peptide is represented by formula (I) below. (I) RN-Xg-[Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj]k-Xh-RC. In formula (I), RN represents an N-terminal group; RC represents a C-terminal group; X1 represents an L-leucine residue, L-isoleucine residue, L-methionine residue, L-lysine residue, or L-arginine residue; X2 represents an L-valine residue or L-isoleucine residue; X3 represents an L-tryptophan residue or L-phenylalanine residue; one among Xa and Xb represents an amino acid residue derived from an amino acid having an azide group in a side chain, the other represents an amino acid residue derived from an amino acid having an alkynyl group in a side chain, and Xa and Xb are bonded via a triazole bond; Xg, Xh, Xi, Xj, Xm, and Xn respectively represent contiguous g X's, contiguous h X's, contiguous i X's, contiguous j X's, contiguous m X's, and contiguous n X's; X represents an amino acid residue, and when there are a plurality of X's, the plurality of X's may be the same or different; g, h, i, and j are each independently an integer of 0 or greater; m and n are integers satisfying 0=m=9, 0=n=9, and 3=m+n=9; and k is an integer of 1 or greater, and when k=2, each of X1, X2, X3, Xa, Xb, Xi, Xj, Xm, and Xn may be the same or different for each of the repeating units [Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj].
C07K 7/00 - Peptides ayant de 5 à 20 amino-acides dans une séquence entièrement déterminée; Leurs dérivés
A61K 47/65 - Séquences de liaison, liants ou bras-espaceurs peptidiques, p.ex. séquences de liaison peptidiques vulnérable aux protéases
A61K 47/68 - Préparations médicinales caractérisées par les ingrédients non actifs utilisés, p.ex. les supports ou les additifs inertes; Agents de ciblage ou de modification chimiquement liés à l’ingrédient actif l’ingrédient non actif étant chimiquement lié à l’ingrédient actif, p.ex. conjugués polymère-médicament l’ingrédient non actif étant un agent de modification l’agent de modification étant un anticorps, une immunoglobuline ou son fragment, p.ex. un fragment Fc
An object of the present invention is to provide an anti-tumor agent and an anti-turnor kit which have superior anti-tumor effect as compared with a therapy with gerncitabine, paclitaxel or a combination thereof; as well as an anti-tumor effect enhancer. According to the present invention, provided is an anti-tumor agent including paclitaxel or a salt thereof and 1-(2-deoxy-2-fluoro-4-thio-p-D-arabinofuranosyl)cytosine or a salt or prodrug thereof.
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
A61K 9/14 - Préparations médicinales caractérisées par un aspect particulier à l'état particulaire, p.ex. poudres
A61K 31/337 - Composés hétérocycliques ayant l'oxygène comme seul hétéro-atome d'un cycle, p.ex. fungichromine ayant des cycles à quatre chaînons, p.ex. taxol
A61K 47/42 - Protéines; Polypeptides; Leurs produits de dégradation; Leurs dérivés p.ex. albumine, gélatine ou zéine
Provided is a method for industrially producing 5-(bromomethyl)-1-benzothiophene. The production method according to the present invention comprises: (1) a step for introducing 5-methyl-1-benzothiophene, a brominating agent, and a solvent into a reactor; (2) a step for emitting light having a wavelength range of 200-780 nm inside the reactor; and (3) a step for recovering 5-(bromomethyl)-1-benzothiophene from the reactor.
C07D 333/54 - Benzo [b] thiophènes; Benzo [b] thiophènes hydrogénés avec uniquement des atomes d'hydrogène, des radicaux hydrocarbonés ou des radicaux hydrocarbonés substitués, liés directement aux atomes de carbone de l'hétérocycle
An object of the present invention is to provide a liquid medicinal preparation which does not generate precipitates and is suitable for mass production. According to the present invention, provided is a liquid medicinal preparation that contains 1-(2-deoxy-2-fluoro-4-thio-.beta.-D-arabinofuranosyl)cytosine or a salt thereof, a polyhydric alcohol having a molecular weight of 100 or less, and water. The polyhydric alcohol is preferably glycerin, propylene glycol, or butanediol.
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
Provided is a cyclic peptide that is represented by formula (I) or formula (I'), has excellent antibody-binding characteristics, and also has improved drug stability. Also provided are an affinity chromatography support, a labeled antibody, an antibody-drug conjugate, and a pharmaceutical preparation. RN-Xg-[Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj]k-Xh-RC...(I) In formula (I): Xa and Xb each independently represents an amino acid residue derived from an amino acid that has a thiol group in a side chain thereof other than L-cysteine and D-cysteine, Xa and Xb each being bonded via a disulfide bond; or one of Xa and Xb represents an amino acid residue derived from an amino acid that has a thiol group in a side chain thereof other than L-cysteine and D-cysteine and the other represents an amino acid residue derived from an amino acid that has a haloacetyl group in a side chain thereof, Xa and Xb each being bonded via a thioether bond. RN-Xg-[Xi-Xa-Xm-X1-X2-X3-Xn-Xb-Xj]k-Xh-RC...(I') In formula (I'): one of Xa and Xb represents an amino acid residue derived from L-cysteine or D-cysteine and the other represents an amino acid residue derived from an amino acid that has a haloacetyl group in a side chain thereof, Xa and Xb each being bonded via a thioether bond; or one of Xa and Xb represents an amino acid residue derived from L-penicillamine or D-penicillamine and the other represents an amino acid residue derived from an amino acid that has a haloacetyl group in a side chain thereof, Xa and Xb each being bonded via a thioether bond.
C07K 7/00 - Peptides ayant de 5 à 20 amino-acides dans une séquence entièrement déterminée; Leurs dérivés
A61K 47/50 - Préparations médicinales caractérisées par les ingrédients non actifs utilisés, p.ex. les supports ou les additifs inertes; Agents de ciblage ou de modification chimiquement liés à l’ingrédient actif l’ingrédient non actif étant chimiquement lié à l’ingrédient actif, p.ex. conjugués polymère-médicament
An object of the present invention is to provide a method for industrially manufacturing a nitrogen-containing heterocyclic compound which shows excellent FLT3 inhibitory activity and is useful as a pharmaceutical active ingredient of pharmaceutical products. The present invention provides a manufacturing method of a compound represented by General Formula [14] or a salt thereof (in the formula, R1 represents a C1-6 alkyl group which may be substituted; and R8 represents a leaving group or the like). (see above formula)
A61P 43/00 - Médicaments pour des utilisations spécifiques, non prévus dans les groupes
44.
METHOD FOR MANUFACTURING NOVEL NITROGEN-CONTAINING COMPOUND OR SALT THEREOF AND MANUFACTURING INTERMEDIATE OF NOVEL NITROGEN-CONTAINING COMPOUND OR SALT THEREOF
Provided are an efficient method for producing a nitrogen-containing compound or salt thereof to be used in the production of a treatment agent for diseases involving an integrin. Also provided is a production intermediate of the same. A method for producing a novel nitrogen-containing compound or salt thereof, said method comprising: (1) a step for obtaining a compound represented by general formula [10] or salt thereof by an amidation reaction; and (2) a step for deprotecting the compound represented by general formula [10] or salt thereof.
A61P 43/00 - Médicaments pour des utilisations spécifiques, non prévus dans les groupes
C07B 59/00 - Introduction d'isotopes d'éléments dans les composés organiques
C07D 255/02 - Composés hétérocycliques contenant des cycles comportant trois atomes d'azote comme uniques hétéro-atomes du cycle, non prévus par les groupes non condensés avec d'autres cycles
C07D 257/02 - Composés hétérocycliques contenant des cycles comportant quatre atomes d'azote comme uniques hétéro-atomes du cycle non condensés avec d'autres cycles
Disclosed are a compound and a pharmaceutical composition that exhibit an excellent drug efficacy against a tumor, in particular a tumor which has acquired resistance to gemcitabine. Specifically, provided is a thionucleoside derivative represented by General (see formula 1) (in the formula, R1 represents a hydroxyl group which may be protected, a C1- 20 alkoxy group which may be substituted, or the like; R2 represents a C1-20 alkoxy group which may be substituted, a C3-8 cycloalkoxy group which may be substituted, or the like; and R3 represents a hydrogen atom or the like); or a salt thereof. Further, provided is a pharmaceutical composition containing such a thionucleoside derivative or a salt thereof. 153
C07H 19/10 - Radicaux pyrimidine avec le radical saccharide estérifié par des acides phosphoriques ou polyphosphoriques
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
Provided are a polypeptide composition, which can induce a pluripotent stem cell culturing property, particularly, an excellent cell growth ability, and a culture method for pluripotent stern cells using the polypeptide composition. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. In the polypeptide composition, the amount of a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, is equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. The culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.
C12N 5/071 - Cellules ou tissus de vertébrés, p.ex. cellules humaines ou tissus humains
C07K 14/47 - Peptides ayant plus de 20 amino-acides; Gastrines; Somatostatines; Mélanotropines; Leurs dérivés provenant d'humains provenant de vertébrés provenant de mammifères
C07K 14/78 - Peptides du tissu connectif, p.ex. collagène, élastine, laminine, fibronectine, vitronectine, globuline insoluble à froid (CIG)
C12M 3/00 - Appareillage pour la culture de tissus, de cellules humaines, animales ou végétales, ou de virus
47.
SALT OF NITROGEN-CONTAINING HETEROCYCLIC COMPOUND OR CRYSTAL THEREOF, PHARMACEUTICAL COMPOSITION, AND FLT3 INHIBITOR
The present invention addresses the problem of providing: a compound exhibiting excellent stability and/or solubility and the like, and further improved FLT3 inhibitory activity; and a pharmaceutical composition. The present invention provides a salt or crystal of (S,E)-N-(1-((5-(2-((4-cyanophenyl)amino)-4-(propylamino)pyrimidine-5-yl)pent-4-yne-1-yl)amino)-1-oxopropane-2-yl)-4-(dimethylamino)-N-methylbuto-2-enamide (compound A). This salt or crystal thereof exhibits excellent FLT3 inhibitory activity, and excellent properties as a drug such as storage stability, solubility, or the like; hence, said salt or crystal thereof is useful in treating a disease or a condition pertaining to FLT3. The present invention provides a pharmaceutical composition and an FLT3 inhibitor which contain this salt or the crystal thereof.
The present invention provides a compound represented by the formula (1) or a salt thereof, or a complex of the compound or the salt with a metal, in the formula (1), A1 represents a chelate group; R1 represents a hydrogen atom or the like; R2 represents a hydrogen atom or the like; and Z1, Z2, Z3, Z4, and Z5 are the same or different and each represent a nitrogen atom or CR2 or the like wherein R2 represents a hydrogen atom or an optionally substituted C1-6 alkyl group or the like; L1 represents a group represented by the formula (3) wherein R13, R14, R15, and R16 are the same or different and each represent a hydrogen atom or the like; L2 represents an optionally substituted C1-6 alkylene group; and L2 represents an optionally substituted C1-6 alkylene group.
C07D 401/12 - Composés hétérocycliques contenant plusieurs hétérocycles comportant des atomes d'azote comme uniques hétéro-atomes du cycle, au moins un cycle étant un cycle à six chaînons avec un unique atome d'azote contenant deux hétérocycles liés par une chaîne contenant des hétéro-atomes comme chaînons
C07F 5/00 - Composés contenant des éléments des groupes 3 ou 13 de la classification périodique
49.
SYNTHETIC INTERMEDIATE OF 1-(2-DEOXY-2-FLUORO-4-THIO-.BETA.-D-ARABINOFURANOSYL)CYTOSINE, SYNTHETIC INTERMEDIATE OF THIONUCLEOSIDE, AND METHODS FOR PRODUCING THE SAME
A compound represented by a formula [1D] as shown below (wherein R1A, R1B, R2A, R2B, R3A and R3B represent a hydrogen atom, an optionally substituted C1- 6 alkyl group, and the like) is useful as an intermediate for producing a thionucleoside, and the production method of the present invention is useful as a method for producing a thionucleoside. (see above formula)
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
C07H 5/02 - Composés contenant des radicaux saccharide dans lesquels les liaisons carbone-oxygène ont été remplacées par le même nombre de liaisons carbone-hétéro-atomes à des atomes d'halogènes, d'azote, de soufre, de sélénium ou de tellure à des halogènes
C07H 5/10 - Composés contenant des radicaux saccharide dans lesquels les liaisons carbone-oxygène ont été remplacées par le même nombre de liaisons carbone-hétéro-atomes à des atomes d'halogènes, d'azote, de soufre, de sélénium ou de tellure au soufre, au sélénium ou au tellure au soufre
C07H 19/04 - Radicaux hétérocycliques contenant uniquement des atomes d'azote comme hétéro-atomes du cycle
A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.
The object is to provide an Fms-like tyrosine kinase 3 (FLT3) inhibitor useful as a therapeutic agent for acute myeloid leukemia (AML). A nitrogen-containing heterocyclic compound represented by the general formula [1] or a salt thereof is provided. The compound or a salt thereof of the present invention can be used as an active ingredient of a pharmaceutical composition for a treatment of a disease or a condition relating to FLT3, such as acute myeloid leukemia (AML) and acute promyelocytie leukemia (APL). (see formula 1)
A61K 31/506 - Pyrimidines; Pyrimidines hydrogénées, p.ex. triméthoprime non condensées et contenant d'autres hétérocycles
A61K 31/5377 - 1,4-Oxazines, p.ex. morpholine non condensées et contenant d'autres hétérocycles, p.ex. timolol
A61K 31/55 - Composés hétérocycliques ayant l'azote comme hétéro-atome d'un cycle, p.ex. guanéthidine ou rifamycines ayant des cycles à sept chaînons, p.ex. azélastine, pentylènetétrazole
A61K 31/551 - Composés hétérocycliques ayant l'azote comme hétéro-atome d'un cycle, p.ex. guanéthidine ou rifamycines ayant des cycles à sept chaînons, p.ex. azélastine, pentylènetétrazole ayant deux atomes d'azote comme hétéro-atomes d'un cycle, p.ex. clozapine, dilazèpe
A61P 35/02 - Agents anticancéreux spécifiques pour le traitement de la leucémie
A61P 43/00 - Médicaments pour des utilisations spécifiques, non prévus dans les groupes
C07D 239/49 - Deux atomes d'azote avec un radical aralkyle, ou un radical aralkyle substitué, lié en position 5, p.ex. triméthoprime
C07D 401/12 - Composés hétérocycliques contenant plusieurs hétérocycles comportant des atomes d'azote comme uniques hétéro-atomes du cycle, au moins un cycle étant un cycle à six chaînons avec un unique atome d'azote contenant deux hétérocycles liés par une chaîne contenant des hétéro-atomes comme chaînons
C07D 401/14 - Composés hétérocycliques contenant plusieurs hétérocycles comportant des atomes d'azote comme uniques hétéro-atomes du cycle, au moins un cycle étant un cycle à six chaînons avec un unique atome d'azote contenant au moins trois hétérocycles
C07D 403/12 - Composés hétérocycliques contenant plusieurs hétérocycles, comportant des atomes d'azote comme uniques hétéro-atomes du cycle, non prévus par le groupe contenant deux hétérocycles liés par une chaîne contenant des hétéro-atomes comme chaînons
C07D 405/12 - Composés hétérocycliques contenant à la fois un ou plusieurs hétérocycles comportant des atomes d'oxygène comme uniques hétéro-atomes du cycle et un ou plusieurs hétérocycles comportant des atomes d'azote comme uniques hétéro-atomes du cycle contenant deux hétérocycles liés par une chaîne contenant des hétéro-atomes comme chaînons
C07D 409/12 - Composés hétérocycliques contenant plusieurs hétérocycles, au moins un cycle comportant des atomes de soufre comme uniques hétéro-atomes du cycle contenant deux hétérocycles liés par une chaîne contenant des hétéro-atomes comme chaînons
52.
SALT OF 1-(2-DEOXY-2-FLUORO-4-THIO-.BETA.-D-ARABINOFURANOSYL)CYTOSINE
The problem of the present invention is to provide a superior anti-tumor agent. A salt of 1-(2-deoxy-2-fluoro-4-thio-ß-D-arabinofuranosyl)cytosine is useful as the active ingredient of a medicine because it has at least one of characteristics such as the following: (1) excellent anti-tumor activity; (2) excellent crystallinity); (3) a high solubility in water; (4) not being deliquescent, (5) having excellent fluidity; (6) having excellent tableting properties; (7) being produced under environmentally friendly conditions; (8) being mass-produced.
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
A superior antitumor agent is provided. A salt of 1-(2-deoxy-2-fluoro-4-thio-.beta.-D-arabinofuranosyl)cytosine shows at least one or more of such characteristics as (1) it has superior antitumor activity, (2) it shows superior crystallinity, (3) it shows high water solubility, (4) it does not show deliquescent property, (5) it shows superior flowability, (6) it shows superior tableting property, (7) it can be manufactured with less environmental load, and (8) it can be manufactured in a large scale, and therefore it is useful as a bulk drug for medicaments.
C07H 19/073 - Radicaux pyrimidine avec un désoxy-2 ribosyle comme radical saccharide
A61K 31/7068 - Composés ayant des radicaux saccharide et des hétérocycles ayant l'azote comme hétéro-atome d'un cycle, p.ex. nucléosides, nucléotides contenant des cycles à six chaînons avec l'azote comme hétéro-atome d'un cycle contenant des pyrimidines condensées ou non-condensées ayant des groupes oxo liés directement au cycle pyrimidine, p.ex. cytidine, acide cytidylique
C30B 7/14 - Croissance des monocristaux à partir de solutions en utilisant des solvants liquides à la température ordinaire, p.ex. à partir de solutions aqueuses le matériau à cristalliser étant produit dans la solution par des réactions chimiques
54.
FREEZING METHOD OF PRODUCING A POROUS POLYMERIC MATERIAL FROM A LIQUID SOLUTION
The invention relates to a method for producing a porous material from a liquid solution including a biocompatible polymer. In certain embodiments of the methods, the biocompatible polymer solution is optionally gelled, then frozen in a controlled fashion. The freezing optionally comprises steps that include: rapidly dropping the temperature to between -10°C and -50°C, so as to form a thin layer of frozen biocompatible polymer gel/solution on the thermally conducting surface; (ii) rapidly raising the temperature of the cooling device, to a temperature below sample Tm; (iii) lowering the temperature of the cooling device so as to induce a constant unidirectional growth rate of ice-crystals, then freeze drying the product.
Provided are a bone regeneration agent and a bone supplementation formulation which can accelerate bone regeneration by means of the actual supplement material carrier. The bone regeneration agent includes gelatin having an amino acid sequence derived from a partial amino acid sequence of collagen.
A heat generating body has a first electrode and a second electrode arranged opposed to each other, and also has a mesh-like electrically conductive membrane (mesh-like pattern) mounted in a curved surface shape between the first electrode and the second electrode. The first electrode and the second electrode are arranged so as to satisfy the relationship of (Lmax - Lmin)/((Lmax + Lmin)/2) <= 0.375, where Lmin is a minimum value of the distance between two opposite points which are on the first and second electrodes and on the electrically conductive membrane and Lmax is a maximum value of the distance.
A cartridge for photographic processing agents, which is formed of containers for photographic processing agents and a storage box for housing the containers in any selected dispositions in the box, in which at least one of the containers is provided with at least one recess on an outer side thereof, and at least one opening is formed on the storage box corresponding to the recess of the container housed in the storage box, and in which the cartridge having the recess in the container and the opening corresponding to recess in the storage box prevents the cartridge from being erroneously loaded to an automatic photo-processor; and a container for a photographic processing agent usable in the cartridge.
B65D 71/06 - Paquets d'objets maintenus ensemble par des éléments d'emballage pour la commodité du stockage ou du transport, p.ex. paquets compartimentés pour le transport à la main de plusieurs réceptacles tels que des boîtes de bière ou des bouteilles de boisso; Balles de matériaux comprenant plusieurs objets entièrement ou en grande partie reliés par des éléments d'emballage, p.ex. sous tension
B65D 77/04 - Objets ou matériaux enfermés dans plusieurs réceptacles disposés les uns dans les autres
G03D 3/06 - Approvisionnement en liquide; Circulation du liquide à l'extérieur des cuves
brevets
